PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.H02896.1.p
Common NameEUGRSUZ_H02896, LOC104414409
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 282aa    MW: 32559.4 Da    PI: 9.1205
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.H02896.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding61.51.7e-192370148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT+eEd+ll+++vk++G g+W+++ar  g++R +k+c++rw +yl
  Eucgr.H02896.1.p 23 KGPWTAEEDKLLIEYVKLHGEGRWNSVARLTGLKRNGKSCRLRWVNYL 70
                      79******************************9*************97 PP

2Myb_DNA-binding50.54.9e-1676120147
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       rg  T++E+  ++++++++G++ W+tIar ++ gRt++++k++w+++
  Eucgr.H02896.1.p  76 RGQITPQEESVILELHARWGNR-WSTIARSLP-GRTDNEIKNYWRTH 120
                       7888******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.4981874IPR017930Myb domain
SuperFamilySSF466892.17E-3021117IPR009057Homeodomain-like
SMARTSM007174.7E-172272IPR001005SANT/Myb domain
PfamPF002496.5E-182370IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.8E-242477IPR009057Homeodomain-like
CDDcd001671.63E-122570No hitNo description
PROSITE profilePS5129419.24775125IPR017930Myb domain
SMARTSM007179.9E-1475123IPR001005SANT/Myb domain
PfamPF002499.0E-1476120IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.0E-2378124IPR009057Homeodomain-like
CDDcd001671.06E-980121No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 282 aa     Download sequence    Send to blast
MSWVAMTGNF GWGSNSMEEA WRKGPWTAEE DKLLIEYVKL HGEGRWNSVA RLTGLKRNGK  60
SCRLRWVNYL RPDLKRGQIT PQEESVILEL HARWGNRWST IARSLPGRTD NEIKNYWRTH  120
FKNKAKASPT NPERSKAARL LRRQQFHHHQ QQQQQQHQQM QQQQQQQLPQ LQQHPQLTQV  180
DMKSIWSLLE ENDHHRVPYT PQIRPEIAGA YPNSSGYDQC LFYSVFNANN ASLPEASSST  240
STDEDVLWDG LWTMEDVHGI NCGAPYATSK ASMHNLVAPF C*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C8e-272312527128MYB TRANSFORMING PROTEIN
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.H02896.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010023809.10.0PREDICTED: myb-related protein 305-like
TrEMBLA0A059B2160.0A0A059B216_EUCGR; Uncharacterized protein
STRINGPOPTR_0008s17350.11e-112(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31072766
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24310.13e-80myb domain protein 305